DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SC35

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:68 Identity:19/68 - (27%)
Similarity:27/68 - (39%) Gaps:13/68 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 IRRGINTSPSSYGGPEF---------EELDDQLQDALYQFLEERGIS--DELAVFLHRYMKNKGK 225
            :|.| :|..|.|||..:         .....|.|..:|.:..|.|.|  :.:|.....|:..| .
  Fly   209 VRPG-STQSSVYGGMTYHYGPAAGPSSHHPAQSQYVIYDYGGEMGPSTAEIIAAQSQDYVDEK-L 271

  Fly   226 AEY 228
            |||
  Fly   272 AEY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.