DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Rbm34

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:58/130 - (44%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            :|...:||...||.:.:..|...|...|.:|.:.::|:..||..:||.::.:|:..:..||: .|
Mouse   288 RDKRSVFVGNLPYKIEDSALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLAL-KL 351

  Fly    96 NGIKILDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCAPKPQLQ--------HIKTEKKDSKN 152
            |..:::.|.|||....:    ||..|.......|..:...||.:|.        |.|..|..|||
Mouse   352 NNSELMGRKLRVMRSVN----KEKLKQQNSNPSLKKDVIKPKQRLNFTSKEGKFHSKEGKFHSKN 412

  Fly   153  152
            Mouse   413  412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/81 (28%)
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:409828
RRM2_RBM34 292..364 CDD:409829 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.