DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBMX2

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_057108.2 Gene:RBMX2 / 51634 HGNCID:24282 Length:322 Species:Homo sapiens


Alignment Length:159 Identity:96/159 - (60%)
Similarity:123/159 - (77%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPLTNMKNVLKLSEHELQHG--GKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNI 63
            |||||.:|.:.:|:|.|:|.|  .|.|||..||||||||:.|.||.|||||::||||||||:|||
Human     1 MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNI 65

  Fly    64 NLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLR 128
            ||:||.|||||||||||||||||||:|||||.|||||..||:|||||::|:.||::|::|:.|.:
Human    66 NLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQ 130

  Fly   129 LYMEGC---APKPQLQHIKTEKKDSKNYR 154
            |..:||   .|.|.|.....::|.:|.::
Human   131 LQEKGCGARTPSPSLSESSEDEKPTKKHK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 70/87 (80%)
RRM <36..>126 CDD:223796 66/89 (74%)
RBMX2NP_057108.2 RRM_ist3_like 27..115 CDD:409845 70/87 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..322 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159048
Domainoid 1 1.000 128 1.000 Domainoid score I5347
eggNOG 1 0.900 - - E1_KOG0126
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136037
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484811at2759
OrthoFinder 1 1.000 - - FOG0004481
OrthoInspector 1 1.000 - - oto91383
orthoMCL 1 0.900 - - OOG6_102431
Panther 1 1.100 - - LDO PTHR45880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R621
SonicParanoid 1 1.000 - - X3770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.