DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and rbm8a

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001013363.1 Gene:rbm8a / 503767 ZFINID:ZDB-GENE-050306-51 Length:174 Species:Danio rerio


Alignment Length:88 Identity:29/88 - (32%)
Similarity:48/88 - (54%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WI-FVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGI 98
            || ||.|.....||.|:...|:::||:.|::|..|.:||..||:..:.||..:....|::.|||.
Zfish    73 WILFVTGVHEEATEEDVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQ 137

  Fly    99 KILDRTLRVDHVADYKPPKENEK 121
            :::.:.:.||......|||...:
Zfish   138 ELMGQPISVDWCFVRGPPKSKRR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 26/78 (33%)
rbm8aNP_001013363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
RRM_RBM8 67..154 CDD:409762 26/80 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.