DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Ref1

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:95 Identity:18/95 - (18%)
Similarity:41/95 - (43%) Gaps:13/95 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SW-HDMY-----------KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGF 77
            :| ||||           .....:.|....|.::..|:..:|:.:|.:....:..| ::|:|.|.
  Fly    88 AWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGT 151

  Fly    78 CFLCYEDQRSTVLAVDNLNGIKILDRTLRV 107
            ..:.:|.:...:.|:...:|:.:..|.:.:
  Fly   152 ADVIFERRADALKAIKQYHGVPLDGRPMTI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 18/95 (19%)
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 18/95 (19%)
RRM_THOC4 109..183 CDD:410081 13/74 (18%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.