DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and CG6937

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:45/95 - (47%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :.|...|:...|..|...|.|:|.|:.:.|.|..:||.|||:.|:.:|......:|.|.::...:
  Fly    53 VIVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEVAKVAADTMDNYLM 117

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRLY 130
            ..:.::    |.|.||      :::||..:
  Fly   118 FQKVVK----ATYIPP------EKQTLNFF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 20/76 (26%)
CG6937NP_651066.2 RRM_NIFK_like 52..125 CDD:409748 19/75 (25%)
RRN3 <242..>306 CDD:461623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.