DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SLIRP2

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:77 Identity:24/77 - (31%)
Similarity:38/77 - (49%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            :.|..:||...|:|:...:|...||:||.|.|..::.|.:.|.||.:.|:.: .||....:..|.
  Fly     7 RSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVF-SQRDAFNSASNQ 70

  Fly    96 NGIKILDRTLRV 107
            |...:..|.|.|
  Fly    71 NTHFLDGRVLTV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 24/77 (31%)
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 23/73 (32%)

Return to query results.
Submit another query.