DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and pabpn1

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_998424.1 Gene:pabpn1 / 406543 ZFINID:ZDB-GENE-040426-2401 Length:284 Species:Danio rerio


Alignment Length:118 Identity:29/118 - (24%)
Similarity:44/118 - (37%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRS--TVLAVD- 93
            |...|:|....|..|..:|...|...|.|..:.::.|..||..|||.::.:.|:.|  |.:|:| 
Zfish    96 DGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDE 160

  Fly    94 ---------------NLNGIKILDR--------------TLRVDHVADYKPPK 117
                           |..||...||              :.|..:.:.|.||:
Zfish   161 SLFRGRQIKVGAKRTNRPGISTTDRGFPRARFRSRGGNFSSRARYYSGYTPPR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 26/112 (23%)
pabpn1NP_998424.1 RRM_II_PABPN1 99..174 CDD:409966 19/74 (26%)

Return to query results.
Submit another query.