DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and cstf2

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_009289373.1 Gene:cstf2 / 386806 ZFINID:ZDB-GENE-031118-2 Length:508 Species:Danio rerio


Alignment Length:112 Identity:43/112 - (38%)
Similarity:59/112 - (52%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||...||..||..|..:||:.|.||:..|:.|.:|||.||:.|..|:||.:.:.|:.||||.:.
Zfish    26 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 90

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRL----------YMEGCAPK 137
            ..|.||||:.|       :||..||...|          |.:||.|:
Zfish    91 SGRALRVDNAA-------SEKNKEELKSLGTGAPIIESPYGDGCMPE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 34/76 (45%)
RRM <36..>126 CDD:223796 37/89 (42%)
cstf2XP_009289373.1 RRM <24..>112 CDD:223796 38/92 (41%)
RRM_CSTF2_CSTF2T 26..100 CDD:241115 33/73 (45%)
CSTF2_hinge 121..199 CDD:291025 4/10 (40%)
CSTF_C 464..504 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.