DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Rbmx2

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001107258.2 Gene:Rbmx2 / 367930 RGDID:1562693 Length:328 Species:Rattus norvegicus


Alignment Length:165 Identity:100/165 - (60%)
Similarity:120/165 - (72%) Gaps:14/165 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPLTNMKNVLKLSEHELQHG--GKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNI 63
            |||||.:|.:.:|:|.|:|.|  .|.|||..||||||||:.|.||.|||||::||||||||:|||
  Rat     1 MNPLTKVKLINELNEREVQLGVAEKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNI 65

  Fly    64 NLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLR 128
            ||:||.|||||||||||||||||||||||||.|||||..||:||||||:|:.|:|:|.:|:.|..
  Rat    66 NLVRDKKTGKSKGFCFLCYEDQRSTVLAVDNFNGIKIKGRTIRVDHVANYRAPQESEDVDDVTRE 130

  Fly   129 LYMEGCAPK------PQLQH------IKTEKKDSK 151
            |..:||..|      |::..      .|..|||.|
  Rat   131 LQEKGCGAKTPPSSPPEVSEDEDAKVTKKPKKDKK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 72/87 (83%)
RRM <36..>126 CDD:223796 68/89 (76%)
Rbmx2NP_001107258.2 RRM_ist3_like 27..115 CDD:240857 72/87 (83%)
RRM <38..>110 CDD:223796 58/71 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..328 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353053
Domainoid 1 1.000 129 1.000 Domainoid score I5153
eggNOG 1 0.900 - - E1_KOG0126
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136037
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484811at2759
OrthoFinder 1 1.000 - - FOG0004481
OrthoInspector 1 1.000 - - oto98463
orthoMCL 1 0.900 - - OOG6_102431
Panther 1 1.100 - - LDO PTHR45880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3770
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.