DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and tra2

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:101 Identity:30/101 - (29%)
Similarity:53/101 - (52%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELQHGGKKSWHD---MYKD------SAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTG 72
            |.:|...:|..|   |:|.      |..|.|.|.....::..:..:|::||.:..|.::.|::|.
  Fly    71 EPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQ 135

  Fly    73 KSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVD 108
            :|:||||:.:|.......|.|:.:||::..|.:|||
  Fly   136 RSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 28/93 (30%)
RRM <36..>126 CDD:223796 23/73 (32%)
tra2NP_476764.1 RRM <74..242 CDD:223796 29/98 (30%)
RRM_TRA2 98..175 CDD:240809 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.