DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and eIF4B

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:50/124 - (40%) Gaps:26/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FVAGFPYTLTEGDLVCVFSQYGEVVNINLI------RDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            ::...|:...|.||...|.      .||||      .|.:.|:|:||.::..|: |..::.|.:|
  Fly    83 YINNLPFDANEDDLYEFFE------GINLISLRLPREDGENGRSRGFGYVELEN-REDLIHVLSL 140

  Fly    96 NGIKILDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCAPKPQLQHIKTEKKDSKNYR 154
            ....|..|.:|::      ...||::...:......:|...       ..:.:||.|:|
  Fly   141 PDPSIKGRRIRIE------LSNENDQQSRQKSNRRFDGFGN-------NGDNRDSGNWR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 21/81 (26%)
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 22/88 (25%)

Return to query results.
Submit another query.