DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and tia1l

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_956476.1 Gene:tia1l / 323447 ZFINID:ZDB-GENE-030131-2167 Length:342 Species:Danio rerio


Alignment Length:134 Identity:33/134 - (24%)
Similarity:61/134 - (45%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KKSW----HDMYKDSA---WIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFL 80
            |.:|    ....||::   .:||......::..|:...|:.:|::.:..:::|..||||||:.|:
Zfish    79 KVNWASTPSSQKKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFI 143

  Fly    81 CYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKP--PKENEKMDEETLRLYMEGCAPKPQLQHI 143
            .:.::.....|:..:||..:..|.:|.:. |..||  ||.|.           ||.:.|    |:
Zfish   144 SFINKWDAESAIQQMNGQWLGGRQIRTNW-ATRKPSAPKSNN-----------EGASSK----HL 192

  Fly   144 KTEK 147
            ..|:
Zfish   193 SYEE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/94 (23%)
tia1lNP_956476.1 RRM_SF 10..83 CDD:473069 1/3 (33%)
RRM2_TIA1_like 98..172 CDD:409789 18/73 (25%)
RRM3_TIAR 206..278 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.