DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and nifk

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_775395.2 Gene:nifk / 317644 ZFINID:ZDB-GENE-021231-4 Length:269 Species:Danio rerio


Alignment Length:120 Identity:34/120 - (28%)
Similarity:59/120 - (49%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            ::|...|..|.|..|...|.|:|:|:.:.:.|..|||.|||:.|:.:|......:..:.:|...:
Zfish    47 LYVGHLPRGLFEPQLKSYFEQFGKVLRLRVSRSKKTGGSKGYGFVEFECDEVAKIVAETMNNYLM 111

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCA--PKPQ----LQHIKTEKKD 149
            .:|.::. ||.   ||   ||:.|   :|::...|  .||:    .::.||..:|
Zfish   112 GERIIKC-HVI---PP---EKVHE---KLFVGSIAGFKKPKYPAVTRYNKTHTED 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/76 (29%)
nifkNP_775395.2 PABP-1234 45..>202 CDD:130689 34/120 (28%)
RRM_NIFK_like 46..119 CDD:409748 20/72 (28%)
hNIFK_binding 204..>224 CDD:463489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..269
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.