DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and TRA2A

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:108 Identity:32/108 - (29%)
Similarity:59/108 - (54%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLI 66
            :|::|.:          :|.|.::..|   .:..:.|.|.....||.||..|||:||.:..:|::
Human   100 SPMSNRR----------RHTGSRANPD---PNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVV 151

  Fly    67 RDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDH 109
            .|.:||:|:||.|:.:|....:..|::..||:::..|.:|||:
Human   152 YDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 28/85 (33%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 5/30 (17%)
RRM_TRA2 118..197 CDD:409798 27/77 (35%)
Linker 198..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.