DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Srsf9

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001009255.1 Gene:Srsf9 / 288701 RGDID:1309495 Length:221 Species:Rattus norvegicus


Alignment Length:126 Identity:29/126 - (23%)
Similarity:48/126 - (38%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSK----GFCFLCYEDQRSTVLAVDNLN 96
            |:|...|..:.|.||..:|.:||.:..|.|       |::    .|.|:.:||.|....|:...|
  Rat    16 IYVGNLPTDVREKDLEDLFYKYGRIREIEL-------KNRHGLVPFAFVRFEDPRDAEDAIYGRN 73

  Fly    97 GIKILDRTLRVDHVADY-------KPPKENEKMDEETLRLYMEGCAPKPQLQHIKTEKKDS 150
            |.......|||:....|       :..:..........|:.:.|..|....|.:|...:::
  Rat    74 GYDYGQCRLRVEFPRAYGGRGGWPRASRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/80 (29%)
Srsf9NP_001009255.1 RRM1_SRSF9 15..86 CDD:241042 23/76 (30%)
RRM2_SRSF9 103..186 CDD:410161 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..221
Interaction with SAFB1. /evidence=ECO:0000250 188..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.