DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBMX

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:104 Identity:28/104 - (26%)
Similarity:49/104 - (47%) Gaps:12/104 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :|:.|......|..|..||.:||.:|.:.|::|.:|.||:||.|:.:|.......|..::||..:
Human    10 LFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCAPKPQ 139
            ..:.::|:...  ||..|:.:          .|..|.|:
Human    75 DGKAIKVEQAT--KPSFESGR----------RGPPPPPR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/76 (29%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 22/77 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 10/53 (19%)
dnaA 165..>306 CDD:455861
RBM1CTR 173..217 CDD:400429
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.