DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and drr-2

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_499818.1 Gene:drr-2 / 259546 WormBaseID:WBGene00011730 Length:207 Species:Caenorhabditis elegans


Alignment Length:78 Identity:22/78 - (28%)
Similarity:41/78 - (52%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FVAGFPYTLTEGDLV-----CVFS-QYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            |:.|.||.....|:.     |.|: :..:..:|:|:.|..:|..|||.::.:|:::....|:..|
 Worm     9 FIGGLPYDSIATDIETILKHCKFTDEELKKFDIHLVHDRDSGSFKGFAYVTFENEQQMNTAISGL 73

  Fly    96 NGIKILDRTLRVD 108
            ||....:|.|:|:
 Worm    74 NGADFGNRVLKVN 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/78 (28%)
drr-2NP_499818.1 RRM 9..89 CDD:440488 22/78 (28%)

Return to query results.
Submit another query.