DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and cwf29

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_596479.1 Gene:cwf29 / 2541212 PomBaseID:SPBC887.05c Length:217 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:65/118 - (55%)
Similarity:87/118 - (73%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRD 68
            :.:::.:.:|:|.||......|||..|.|||:|::....:.|.|.|::||||::||.|:|||:||
pombe     1 MNSIRQIERLNEQELDKPFSSSWHQDYSDSAYIYIGNLDFDLNEDDILCVFSEFGEPVDINLVRD 65

  Fly    69 SKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYK-PPKENE 120
            .:|||||||.||.|||||||||||||:..:|:|||.:||||||.|| |.||.|
pombe    66 KETGKSKGFAFLKYEDQRSTVLAVDNMTNVKLLDRLVRVDHVASYKVPQKEKE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 55/87 (63%)
RRM <36..>126 CDD:223796 54/86 (63%)
cwf29NP_596479.1 RRM <6..180 CDD:223796 65/113 (58%)
RRM_ist3_like 22..110 CDD:240857 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I1951
eggNOG 1 0.900 - - E1_KOG0126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1375
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004481
OrthoInspector 1 1.000 - - oto101964
orthoMCL 1 0.900 - - OOG6_102431
Panther 1 1.100 - - LDO PTHR45880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R621
SonicParanoid 1 1.000 - - X3770
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.