DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and ctf1

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_596669.1 Gene:ctf1 / 2541018 PomBaseID:SPBC3B9.11c Length:363 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:33/99 - (33%)
Similarity:54/99 - (54%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||...||.::|..:..:|:|.|.|....|:.|.:||..||:.|..:.|..:|.:||..||..::
pombe     9 VFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRKLNNSEL 73

  Fly   101 LDRTLRVDHVADYKPPKENEKMD--EETLRLYME 132
            ..|.:||:..::  .|:.|:..:  |.|.| |||
pombe    74 GPRKIRVEFPSN--DPRRNQSYEYTERTDR-YME 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 25/76 (33%)
RRM <36..>126 CDD:223796 28/91 (31%)
ctf1NP_596669.1 RRM_CSTF2_RNA15_like 9..83 CDD:240844 25/73 (34%)
CSTF2_hinge 208..281 CDD:291025
CSTF_C 329..359 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.