DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Eif4h

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_291039.1 Gene:Eif4h / 22384 MGIID:1341822 Length:248 Species:Mus musculus


Alignment Length:57 Identity:14/57 - (24%)
Similarity:23/57 - (40%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 YGGPEFEELDDQLQDALYQFLEERGISDELAVFLHRYMK-NKGKAEYVR-WMESVKS 237
            |...:|.....|:.|.||       ...:|...|..|:| .:.:.|.|: |.:.:.|
Mouse    16 YAHNDFFTSTGQMTDLLY-------AEKDLVTSLKEYIKQEENRLEQVKEWADKLDS 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845
Eif4hNP_291039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 7/31 (23%)
RRM_eIF4H 37..120 CDD:409835 8/29 (28%)
SF-CC1 <40..>227 CDD:273721 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.