powered by:
Protein Alignment CG10466 and rsp-8
DIOPT Version :9
Sequence 1: | NP_001260601.1 |
Gene: | CG10466 / 35268 |
FlyBaseID: | FBgn0032822 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255142.1 |
Gene: | rsp-8 / 176613 |
WormBaseID: | WBGene00004705 |
Length: | 309 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 23/66 - (34%) |
Similarity: | 34/66 - (51%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 YTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRV 107
|| ||.||..||.::||:...:|:.|..:|.|:||.|:.:........|.|.|....:....:||
Worm 86 YT-TEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRV 149
Fly 108 D 108
|
Worm 150 D 150
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.