DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and rnp-4

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001369846.1 Gene:rnp-4 / 175572 WormBaseID:WBGene00004387 Length:142 Species:Caenorhabditis elegans


Alignment Length:75 Identity:28/75 - (37%)
Similarity:42/75 - (56%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WI-FVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGI 98
            || ||.......||.|:...||:||::.||:|..|.:||..||:..:.||.|:....|:|..|..
 Worm    55 WIVFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAIDQSNDT 119

  Fly    99 KILDRTLRVD 108
            .:|.:.::||
 Worm   120 DLLGQNVKVD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 28/75 (37%)
rnp-4NP_001369846.1 RRM_RBM8 49..136 CDD:409762 28/75 (37%)

Return to query results.
Submit another query.