DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and pabp-2

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_492504.1 Gene:pabp-2 / 172768 WormBaseID:WBGene00003904 Length:205 Species:Caenorhabditis elegans


Alignment Length:93 Identity:21/93 - (22%)
Similarity:39/93 - (41%) Gaps:14/93 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCY---EDQRSTVLAVD 93
            |:..::|....|..|..::...|...|.|..:.:..|..:|..|||.::.:   |..::.:...|
 Worm    76 DAKSVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTD 140

  Fly    94 NLNGIKILDRTLRVDHVADYKPPKENEK 121
            :|    :..|.::||       ||...|
 Worm   141 SL----LRGRQIKVD-------PKRTNK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 18/83 (22%)
pabp-2NP_492504.1 RRM_SF 79..154 CDD:473069 18/85 (21%)

Return to query results.
Submit another query.