DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Pabp2

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_061498749.1 Gene:Pabp2 / 1274794 VectorBaseID:AGAMI1_009745 Length:221 Species:Anopheles gambiae


Alignment Length:86 Identity:19/86 - (22%)
Similarity:36/86 - (41%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQR--STVLAVDN 94
            |:..|:|....|..|..:|...|...|.:..:.::.:...|..|||.::.:..:.  .|.||   
Mosquito    91 DNRSIYVGNVDYGATAEELEAHFHGCGAINRVTILCNKADGHPKGFAYIEFGSKEFVETALA--- 152

  Fly    95 LNGIKILDRTLRVDHVADYKP 115
            :|......|.::|:.....:|
Mosquito   153 MNETLFRGRQIKVNPKRTNRP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 18/82 (22%)
Pabp2XP_061498749.1 None

Return to query results.
Submit another query.