DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Tra2b

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_476460.1 Gene:Tra2b / 117259 RGDID:619886 Length:288 Species:Rattus norvegicus


Alignment Length:97 Identity:28/97 - (28%)
Similarity:53/97 - (54%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYE 83
            :|.|.::..|   .:..:.|.|.....||.||..|||:||.:.:::::.|.::.:|:||.|:.:|
  Rat   106 RHVGNRANPD---PNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFE 167

  Fly    84 DQRSTVLAVDNLNGIKILDRTLRVDHVADYKP 115
            :......|.:..||:::..|.:|||.....:|
  Rat   168 NVDDAKEAKERANGMELDGRRIRVDFSITKRP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 25/87 (29%)
RRM <36..>126 CDD:223796 25/80 (31%)
Tra2bNP_476460.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 2/7 (29%)
RRM_TRA2 117..196 CDD:409798 24/78 (31%)
Linker 193..230 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.