DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Tra2b

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_476460.1 Gene:Tra2b / 117259 RGDID:619886 Length:288 Species:Rattus norvegicus


Alignment Length:97 Identity:28/97 - (28%)
Similarity:53/97 - (54%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYE 83
            :|.|.::..|   .:..:.|.|.....||.||..|||:||.:.:::::.|.::.:|:||.|:.:|
  Rat   106 RHVGNRANPD---PNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFE 167

  Fly    84 DQRSTVLAVDNLNGIKILDRTLRVDHVADYKP 115
            :......|.:..||:::..|.:|||.....:|
  Rat   168 NVDDAKEAKERANGMELDGRRIRVDFSITKRP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 25/87 (29%)
Tra2bNP_476460.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 2/7 (29%)
RRM_TRA2 117..196 CDD:409798 24/78 (31%)
Linker 193..230 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.