DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SNRNP35

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens


Alignment Length:81 Identity:28/81 - (34%)
Similarity:46/81 - (56%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :|||.......|..|..|||:||::..:.|:||..||.|||:.|:.|:::|:.:.|..:.:|:.|
Human    58 LFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVI 122

  Fly   101 ----------LDRTLR 106
                      |:|||:
Human   123 DQHEIFVDYELERTLK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 28/81 (35%)
SNRNP35NP_851030.1 RRM_snRNP35 52..142 CDD:409683 28/81 (35%)

Return to query results.
Submit another query.