DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SRSF10

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:96 Identity:26/96 - (27%)
Similarity:44/96 - (45%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||..........||...|.:||.:|::.:..|..|.:.:||.::.:||.|....|:.||:...|
Human    12 LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWI 76

  Fly   101 LDRTLRVDHV-ADYKPPKENEKMDEETLRLY 130
            ..|.:.:... .|.|.|  |:...:|...:|
Human    77 CGRQIEIQFAQGDRKTP--NQMKAKEGRNVY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 20/77 (26%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:473069 24/88 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.