DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Tra2a

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006505303.1 Gene:Tra2a / 101214 MGIID:1933972 Length:309 Species:Mus musculus


Alignment Length:108 Identity:32/108 - (29%)
Similarity:59/108 - (54%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLI 66
            :|::|.:          :|.|.::..|   .:..:.|.|.....||.||..|||:||.:..:|::
Mouse   125 SPMSNRR----------RHTGSRANPD---PNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVV 176

  Fly    67 RDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDH 109
            .|.:||:|:||.|:.:|....:..|::..||:::..|.:|||:
Mouse   177 YDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 28/85 (33%)
RRM <36..>126 CDD:223796 27/74 (36%)
Tra2aXP_006505303.1 RRM_TRA2 143..222 CDD:409798 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.