powered by:
Protein Alignment CG10466 and Gm21693
DIOPT Version :9
Sequence 1: | NP_001260601.1 |
Gene: | CG10466 / 35268 |
FlyBaseID: | FBgn0032822 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257443.1 |
Gene: | Gm21693 / 100862383 |
MGIID: | 5435048 |
Length: | 380 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 36/67 - (53%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
||:.|......:..|..:|.::|.|..:.|:||.:|.||:||.||.:........||..:||: |
Mouse 10 IFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEMNGV-I 73
Fly 101 LD 102
||
Mouse 74 LD 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.