DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and AT1G08340

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_172310.1 Gene:AT1G08340 / 837354 AraportID:AT1G08340 Length:331 Species:Arabidopsis thaliana


Alignment Length:266 Identity:61/266 - (22%)
Similarity:119/266 - (44%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GQDIPMVLRSCAEFIENYGVI--DGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSS 496
            |..:|::|......:.:.|.:  :|::|::|..|..:.:|...::..:||      ..|:|.::.
plant    61 GNCVPVILLLLQSRLYDQGGLQAEGVFRITGENSEEEFVREQLNKGIIPD------GIDVHCLAG 119

  Fly   497 LLKMYFRELP----NPLCTYQLYDNFVEAIQVKADEADER-LRLMKETVLKLPPPHYRTLKYLAE 556
            |:|.:|||||    :||.:.|:       :|.::||...: :||:.:|...|       |.:...
plant   120 LIKAWFRELPRGVLDPLPSEQV-------MQCESDEDFVKVVRLLPQTEASL-------LNWAIN 170

  Fly   557 HLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIFDAL 621
            .:..|.|......|..:|||:|:|||:.:.....:..:.|::.:.:...:||..:|         
plant   171 LMADVIQFEHVNKMNSRNLALVFAPNMSQMADPLTALMYAVQVMKLLKSLTEKTVR--------- 226

  Fly   622 DDHPARHSMVASATAAAANAAGGELRLESLTDCESLLVEQREQDQSLGVVERPKSLSTGGAKLIS 686
             :..|..|:|  ....:..|..||...::..:.|....|:.|:|:     :..:.....|..:|.
plant   227 -EREASSSVV--DRRCSKEAEDGEKEKDNEEEEEDEEEEEEEEDE-----DEDEEEEGDGVYIIK 283

  Fly   687 LEEAQE 692
            .|||.|
plant   284 EEEASE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769
RhoGAP_CdGAP 420..613 CDD:239849 44/185 (24%)
FliJ 1322..1457 CDD:304890
AT1G08340NP_172310.1 PBD 3..37 CDD:197628
RhoGAP 65..217 CDD:238090 41/171 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.