DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and AT5G61530

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_001190587.1 Gene:AT5G61530 / 836274 AraportID:AT5G61530 Length:376 Species:Arabidopsis thaliana


Alignment Length:303 Identity:70/303 - (23%)
Similarity:127/303 - (41%) Gaps:72/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 IWWRG--KKSHLQKSLYEVGFFPQSCVATIGDKVPRNFPMPAPLVGHLDAS--------PTKPVL 388
            :||:.  ..:.|...|.|.|....|.|..:......|....|..||.|..|        .|:..:
plant     9 LWWKAYYGVTELGTKLREAGQTAGSFVGEVAKDAKVNVADVAERVGSLFKSRWAILQQPATRHAV 73

  Fly   389 RKHGKLI-------AFFRSFI----------------LSRPSRRRLK---------QSGIYRERV 421
            ::|  ||       .|.|..|                .::.:.::.|         |.|:....|
plant    74 QEH--LITAAATTGTFVRKGITETKEKVSVGKIKVEEAAKKTAQKSKTILTDIERWQKGVASSDV 136

  Fly   422 FN--CDLSEHLLNSGQDIPMVLRSCAEFIENYGVIDG-----IYRLSGITSNIQRLRRAFDEE-- 477
            |.  .:::.....|.:.||::|..||:::    ::.|     :::..|....||:|..|::::  
plant   137 FGVAIEITVQRQESSRPIPLILVKCADYL----ILTGLNSPNLFKAEGDRKLIQQLVSAYNQDPR 197

  Fly   478 -RVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVL 541
             .:|:..||.      .|::|||.|...||.||.|::||:      ::|  :|...:..|::::.
plant   198 ASIPEGVNPV------DVAALLKYYLASLPTPLTTFELYN------EIK--DARSSIHRMRQSLQ 248

  Fly   542 KLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLL 584
            ||...:|.||:::...|.:|||......|...:||:..||.::
plant   249 KLSNVNYNTLEFITALLLRVSQKSLLNKMDSHSLAMEMAPVIM 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769 7/25 (28%)
RhoGAP_CdGAP 420..613 CDD:239849 46/175 (26%)
FliJ 1322..1457 CDD:304890
AT5G61530NP_001190587.1 RhoGAP 155..299 CDD:279014 42/155 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.