DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and AT3G11490

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_187756.1 Gene:AT3G11490 / 820322 AraportID:AT3G11490 Length:435 Species:Arabidopsis thaliana


Alignment Length:326 Identity:69/326 - (21%)
Similarity:132/326 - (40%) Gaps:90/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GQDIPMVLRSCAEFIENYG--VIDGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSS 496
            |..:|.:|......:.:.|  .::||:|::|.....:.:|...::..:||      ..|:|.::|
plant   151 GNIVPTILLMMQSHLYSRGGLRVEGIFRINGENGQEEYIREELNKGIIPD------NIDVHCLAS 209

  Fly   497 LLKMYFRELP----NPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEH 557
            |:|.:|||||    :.|...|:.::..|      ||..|.:||:..|...|       |.:....
plant   210 LIKAWFRELPSGVLDSLSPEQVMESESE------DECVELVRLLPSTEASL-------LDWAINL 261

  Fly   558 LYKVSQHHGRTGMTDKNLAIVWAPNL--LRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIFDA 620
            :..|.:......|..:|:|:|:|||:  :..|.     .|.:..|.|...:...:::...     
plant   262 MADVVEMEQLNKMNARNIAMVFAPNMTQMLDPL-----TALMYAVQVMNFLKTLIVKTLK----- 316

  Fly   621 LDDHPARHSMVASATAAAANAAGGE------LRL------ESLTDCESLLVEQREQDQSLGVVER 673
             |...:|..:|.::..:..:..|.:      |.|      |:|.:.|:   |.:::::|..    
plant   317 -DRKESRDKLVPASNPSPRDHNGDQSSSRQLLHLMKANKEETLDNFEA---EMKDKEESAD---- 373

  Fly   674 PKSLSTGGAKLISLEEAQERHSRVEGADLKQSLPISMLTSAS----------------SNAASNI 722
                          ||.:|....||..|:|:|   |::.::|                |.|:|.:
plant   374 --------------EEEEECAESVELVDIKKS---SLVNNSSGGFGQKHIGWEEQRTMSKASSIV 421

  Fly   723 G 723
            |
plant   422 G 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769
RhoGAP_CdGAP 420..613 CDD:239849 44/186 (24%)
FliJ 1322..1457 CDD:304890
AT3G11490NP_187756.1 CRIB 91..131 CDD:238077
RhoGAP 154..313 CDD:214618 43/182 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.