DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and BCR

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_004318.3 Gene:BCR / 613 HGNCID:1014 Length:1271 Species:Homo sapiens


Alignment Length:223 Identity:78/223 - (34%)
Similarity:112/223 - (50%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 KPVLRKHG---KLIAFF--RSFILSR-PSRRRLKQSGIY---------RERVFNCDLSEHLLNSG 434
            :.|:..:|   ||...|  |.|.|.| |||   ||:|::         |||              
Human  1017 RTVIAMNGIEVKLSVKFNSREFSLKRMPSR---KQTGVFGVKIAVVTKRER-------------- 1064

  Fly   435 QDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLL 498
            ..:|.::|.|.|.||..|:.: ||||:||:.::||.|:.|||... .|:.....:.|::|::..|
Human  1065 SKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNN-KDVSVMMSEMDVNAIAGTL 1128

  Fly   499 KMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQ 563
            |:||||||.||.|.:.|.||.|.|.:....|.|  ..|...:|.||..:..|..:|.:||.:|::
Human  1129 KLYFRELPEPLFTDEFYPNFAEGIALSDPVAKE--SCMLNLLLSLPEANLLTFLFLLDHLKRVAE 1191

  Fly   564 HHGRTGMTDKNLAIVWAPNLLRSPALES 591
            ......|:..|||.|:.|.|||....||
Human  1192 KEAVNKMSLHNLATVFGPTLLRPSEKES 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769
RhoGAP_CdGAP 420..613 CDD:239849 61/173 (35%)
FliJ 1322..1457 CDD:304890
BCRNP_004318.3 Kinase 1..426
Bcr-Abl_Oligo 3..75 CDD:286168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..173
BAT2_N <81..174 CDD:284431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..247
Binding to ABL SH2-domain 197..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..392
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..476
RhoGEF 502..690 CDD:279015
PH_BCR_vertebrate 684..877 CDD:270173
C2_ABR 913..1033 CDD:176068 4/15 (27%)
RhoGAP_Bcr 1052..1252 CDD:239852 63/185 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.