DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and ARHGAP15

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_060930.3 Gene:ARHGAP15 / 55843 HGNCID:21030 Length:475 Species:Homo sapiens


Alignment Length:411 Identity:110/411 - (26%)
Similarity:189/411 - (45%) Gaps:66/411 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LTWLQLDNKG--RRLPLADGETQRTINTPAVGAAYGVRR---YQAQAPDEI-NIEVGDMISVIDM 327
            |..|.::.:|  ::..:|||..:...|..........||   |:......: |::.|.....:|:
Human    75 LEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDL 139

  Fly   328 PSPAESIWWRGKKSHLQKSLYEV------GFFPQS-----------CVATIGDKVPRNFPMPA-- 373
              ....|.|..:||. :|:::::      .|..||           .:....|::|::...|:  
Human   140 --CGAHIEWAKEKSS-RKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRN 201

  Fly   374 ------------PLVGHLDASPTKPVLRKHGKLIAF------------------FRSFILSRPSR 408
                        .|:.|.| |..|....:|.|.:.|                  .:.||..|||.
Human   202 LELFKIQRSSSTELLSHYD-SDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSL 265

  Fly   409 RRLKQSGIYRERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGV-IDGIYRLSGITSNIQRLRR 472
            :.|::.|:.::::|...|.:........:|..::.|.|.:|..|: :|||||:||..:.||:||.
Human   266 KTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRF 330

  Fly   473 AFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMK 537
            ..::|...:|.:.:. :|||.|:..|||:|||||.||..|..::.|||||  |..:.:.|:..:|
Human   331 IVNQEEKLNLDDSQW-EDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAI--KKQDNNTRIEAVK 392

  Fly   538 ETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGV 602
            ..|.|||||:..|:|.|..||.|:.....:..|:.::|.||:.|.|||:.. |:|.:|.  .:..
Human   393 SLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAEN-ETGNMAI--HMVY 454

  Fly   603 QAVVTEYLIRNCHNIFDALDD 623
            |..:.|.::.....||.:.:|
Human   455 QNQIAELMLSEYSKIFGSEED 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365 2/4 (50%)
SH3_ARHGAP32_33 299..358 CDD:212769 14/79 (18%)
RhoGAP_CdGAP 420..613 CDD:239849 68/193 (35%)
FliJ 1322..1457 CDD:304890
ARHGAP15NP_060930.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
PH 80..188 CDD:278594 19/110 (17%)
PH_ARHGAP9-like 81..190 CDD:270053 19/111 (17%)
RhoGAP_ARHGAP27_15_12_9 279..465 CDD:239868 68/191 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1449
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.