Sequence 1: | NP_001260600.1 | Gene: | CdGAPr / 35267 | FlyBaseID: | FBgn0032821 | Length: | 1843 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074881.1 | Gene: | Bcr / 110279 | MGIID: | 88141 | Length: | 1270 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 73/204 - (35%) |
---|---|---|---|
Similarity: | 104/204 - (50%) | Gaps: | 31/204 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 399 RSFILSR-PSRRRLKQSGIY---------RERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGV 453
Fly 454 ID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDN 517
Fly 518 FVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPN 582
Fly 583 LLRSPALES 591 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CdGAPr | NP_001260600.1 | PX_domain | 168..274 | CDD:295365 | |
SH3_ARHGAP32_33 | 299..358 | CDD:212769 | |||
RhoGAP_CdGAP | 420..613 | CDD:239849 | 61/173 (35%) | ||
FliJ | 1322..1457 | CDD:304890 | |||
Bcr | NP_001074881.1 | Kinase. /evidence=ECO:0000250|UniProtKB:P11274 | 1..428 | ||
Bcr-Abl_Oligo | 3..75 | CDD:286168 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 67..173 | ||||
Binding to ABL SH2-domain. /evidence=ECO:0000250 | 198..387 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..249 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 295..396 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 412..481 | ||||
RhoGEF | 501..689 | CDD:279015 | |||
PH-like | 683..876 | CDD:302622 | |||
C2_ABR | 912..1032 | CDD:176068 | |||
RhoGAP_Bcr | 1051..1251 | CDD:239852 | 63/185 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2255 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |