DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CdGAPr and Bcr

DIOPT Version :9

Sequence 1:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster
Sequence 2:NP_001074881.1 Gene:Bcr / 110279 MGIID:88141 Length:1270 Species:Mus musculus


Alignment Length:204 Identity:73/204 - (35%)
Similarity:104/204 - (50%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 RSFILSR-PSRRRLKQSGIY---------RERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGV 453
            |.|.|.| |||   ||:|::         |||              ..:|.::|.|.|.||..|:
Mouse  1035 REFSLKRMPSR---KQTGVFGVKIAVVTKRER--------------SKVPYIVRQCVEEIERRGM 1082

  Fly   454 ID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDN 517
            .: ||||:||:.::||.|:.|||... .|:.....:.|::|::..||:||||||.||.|.:.|.|
Mouse  1083 EEVGIYRVSGVATDIQALKAAFDVNN-KDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPN 1146

  Fly   518 FVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPN 582
            |.|.|.:....|.|  ..|...:|.||..:..|..:|.:||.:|::......|:..|||.|:.|.
Mouse  1147 FAEGIALSDPVAKE--SCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPT 1209

  Fly   583 LLRSPALES 591
            |||....||
Mouse  1210 LLRPSEKES 1218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769
RhoGAP_CdGAP 420..613 CDD:239849 61/173 (35%)
FliJ 1322..1457 CDD:304890
BcrNP_001074881.1 Kinase. /evidence=ECO:0000250|UniProtKB:P11274 1..428
Bcr-Abl_Oligo 3..75 CDD:286168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..173
Binding to ABL SH2-domain. /evidence=ECO:0000250 198..387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..396
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..481
RhoGEF 501..689 CDD:279015
PH-like 683..876 CDD:302622
C2_ABR 912..1032 CDD:176068
RhoGAP_Bcr 1051..1251 CDD:239852 63/185 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.