DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and HB53

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:119 Identity:33/119 - (27%)
Similarity:48/119 - (40%) Gaps:34/119 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHK------- 330
            |:||    .:|.|::.||..|..:..|.:..:.::|..|||...||..||||||.:.|       
plant    71 RKRK----LTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEE 131

  Fly   331 --KQLRRRDNA--------------NEPVDFSRSEPGK-------QPGEATSSS 361
              |.....||.              .|.:..::||..|       .|..::|||
plant   132 YAKLKNHHDNVVLGQCQLESQILKLTEQLSEAQSEIRKLSERLEEMPTNSSSSS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 21/64 (33%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 21/57 (37%)

Return to query results.
Submit another query.