DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and PDF2

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001329475.1 Gene:PDF2 / 825828 AraportID:AT4G04890 Length:743 Species:Arabidopsis thaliana


Alignment Length:127 Identity:36/127 - (28%)
Similarity:55/127 - (43%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 RHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRM------- 327
            ||.:|          |:..||..|:...:....:|.||:..|.|...|||.||||:|.       
plant    68 RHTQR----------QIQELESFFKECPHPDDKQRKELSRDLNLEPLQVKFWFQNKRTQMKAQSE 122

  Fly   328 KHKKQLRRRDNANEPVDFSRSEPGKQPGEATSSSGDSKHGKLNPGSVGGTPTQPTSEQQLQM 389
            :|:.|:.:.||     |..|:|..:.. ||.|::.....|  .|.::|   .....||.|::
plant   123 RHENQILKSDN-----DKLRAENNRYK-EALSNATCPNCG--GPAAIG---EMSFDEQHLRI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 17/58 (29%)
PDF2NP_001329475.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.