powered by:
Protein Alignment bsh and HAT9
DIOPT Version :9
Sequence 1: | NP_477350.2 |
Gene: | bsh / 35266 |
FlyBaseID: | FBgn0000529 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179865.1 |
Gene: | HAT9 / 816811 |
AraportID: | AT2G22800 |
Length: | 274 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 33/66 - (50%) |
Gaps: | 7/66 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 GVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKH 329
|::|.:..|..|.::.. ||:.|:....|:..::..||..|.|...||:.||||||.:.
plant 108 GISARKKLRLTKQQSAL-------LEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRART 165
Fly 330 K 330
|
plant 166 K 166
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
bsh | NP_477350.2 |
Homeobox |
278..330 |
CDD:278475 |
16/51 (31%) |
HAT9 | NP_179865.1 |
HOX |
112..166 |
CDD:197696 |
18/60 (30%) |
HALZ |
168..211 |
CDD:128634 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.