DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and HB17

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:57 Identity:20/57 - (35%)
Similarity:28/57 - (49%) Gaps:2/57 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 RRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHK 330
            |:|.|......:|  ||..|.....|:..::..||..|.|...|::.||||||.:.|
plant   138 RKKLRLTREQSRL--LEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 19/56 (34%)
HB17NP_178252.2 HOX 136..192 CDD:197696 19/55 (35%)
HALZ 194..237 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.