DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and NANOG

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:59 Identity:32/59 - (54%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKK 331
            :::|.|||||..||..|..||:.|:|||..:..||:..|.||..||||||||:|||.|:
Human    94 KKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 31/55 (56%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 0/1 (0%)
COG5576 74..191 CDD:227863 32/59 (54%)
Homeodomain 97..152 CDD:459649 31/54 (57%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 16/28 (57%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.