DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and nanog

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001091862.1 Gene:nanog / 792333 ZFINID:ZDB-GENE-030131-5486 Length:384 Species:Danio rerio


Alignment Length:368 Identity:84/368 - (22%)
Similarity:114/368 - (30%) Gaps:140/368 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HAHANATTP----THSKAAAMASATTMLTTKTPFSIEHILFQNLNSASNNNNSSDTNGIAANTNN 75
            |...|.:.|    |||........|.......|:|.|                   ||.|::|.:
Zfish    31 HGVPNLSWPDAAYTHSGGVTAGYFTAQTAQSPPWSPE-------------------NGGASSTYS 76

  Fly    76 YAPKSSRNA--------VKSARSAFAHDNNPHKHPS-QHSHPPQSHPPASASASATATARSNQAA 131
            ..|..|:|.        .:..:.|...:......|| ..:|.|.|...||:......|   |...
Zfish    77 QYPGHSQNGRLFLSYNKTEPDQKAKDAEQTSSDTPSDSEAHTPDSWSSASSREGVPLT---NLNL 138

  Fly   132 SGYAGEDYGKSMHSTPRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGS 196
            ..:...|| ::...:|.|...:...|:   |:: ...|..|....||:|.....|..||.|    
Zfish   139 PSWRDRDY-ETDSGSPDSGERNLTSTA---GEE-PVNLNLGVDTQPPLPALTASPVRPPTL---- 194

  Fly   197 GASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALG 261
                                                                             
Zfish   195 ----------------------------------------------------------------- 194

  Fly   262 LGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRR 326
                        .||.|..||:.|::.|..||..||||:..|...||.|.||:..||||||||||
Zfish   195 ------------PRKTRAAFSEEQMNALVNRFNVQRYLTPAEMKTLAGATGLTYKQVKTWFQNRR 247

  Fly   327 MKHKKQLRRRDNA------------NEPVDFS--RSEPGKQPG 355
            ||.|:  .:||::            |.|...|  :|||   ||
Zfish   248 MKLKR--HQRDSSWMTERYVVNAVPNTPASQSQFQSEP---PG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 29/51 (57%)
nanogNP_001091862.1 homeodomain 196..254 CDD:238039 32/59 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.