DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Nanog

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:127 Identity:49/127 - (38%)
Similarity:64/127 - (50%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMK----HKKQL 333
            |::|.|||||..||..|:.||:.|:|||..:..||::.|.||..||||||||:|||    .|.|.
Mouse    95 RKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQW 159

  Fly   334 RRRDN-----ANEPVDFSRSEPGKQPGEATSSSGD-SKHGK---LNPGSVGGTPTQPTSEQQ 386
            .:..|     .:.||::.........|...::||. |..|.   .||.....|.|.||...|
Mouse   160 LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 31/59 (53%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 49/127 (39%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 31/58 (53%)
Homeodomain 98..153 CDD:459649 31/54 (57%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 16/28 (57%)
PTZ00395 <190..>250 CDD:185594 11/32 (34%)
10 X repeats starting with a Trp in each unit 198..247 8/24 (33%)
Sufficient for transactivation activity 198..247 8/24 (33%)
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.