DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and vox

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:169 Identity:52/169 - (30%)
Similarity:76/169 - (44%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PPVP-TTQPQPP---------PPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKS 231
            |.|| ..||:||         |.|.:|...                  |:......:|:..|.::
Zfish    31 PHVPCVVQPRPPTSYDKVYLQPKPKINKAE------------------LKTESSKETPAQVTPRN 77

  Fly   232 V-DPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEG 295
            . .|.|...:....|   :.:.....|.| .:..|.:|.:....|:.||.|:..|:..|||.|..
Zfish    78 CSSPSFSENSGYSSG---YESEAAASECA-SVEDGHDAEKDGATRRIRTKFTPEQIDKLEKIFNK 138

  Fly   296 QRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLR 334
            .:||...|||:.|..|||||||::|||||||||.|::::
Zfish   139 HKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 39/107 (36%)
Homeobox 121..173 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.