DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and lbx2

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:270 Identity:73/270 - (27%)
Similarity:108/270 - (40%) Gaps:72/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PPVPTTQPQPP--------------------PPPPL---NGGSGASNGVLYPNAPYTDHGFLQMT 218
            ||..:.:|..|                    ||..|   .|.|.:.||:..|::|.       ..
Zfish    31 PPANSNKPLTPFSIEDILNKPSVKKSVGSLCPPRVLEKVTGSSASRNGISAPSSPL-------CA 88

  Fly   219 LGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSD 283
            |..|  :|.|:|.::...:..|.   |.....|.|             ......:|||:||.|::
Zfish    89 LEEL--ASKTFKGLEVSVIQAAE---GREHINAFG-------------QRQASKKRRKSRTAFTN 135

  Fly   284 PQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRS 348
            .|:..|||||..|:|||..:|.::|..|||:..||.|||||||.|.|:.|   :.....|:..:.
Zfish   136 HQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDL---EEMKADVESLKK 197

  Fly   349 EPGKQPGEATSSSG-DSKHGKLNPGSVG----GTPTQPTSEQQLQMCLMQQGYSTDDYSDLEADS 408
            .|.:...:..|... :..||...|.|..    ..|..|:|         .:|.:||::|      
Zfish   198 IPPQALQKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPSS---------SRGQTTDEFS------ 247

  Fly   409 GDEDNSSDVD 418
             :||...:||
Zfish   248 -EEDEEIEVD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 30/55 (55%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 4/11 (36%)
Homeodomain 127..183 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 16/67 (24%)

Return to query results.
Submit another query.