DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and hmx3a

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571709.3 Gene:hmx3a / 60310 ZFINID:ZDB-GENE-001020-1 Length:297 Species:Danio rerio


Alignment Length:106 Identity:42/106 - (39%)
Similarity:57/106 - (53%) Gaps:23/106 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 CRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLR-- 334
            ||::|.|||||..|:..||..|:.:||||:.||..||.:|.|:|||||.||||||.|.|:||.  
Zfish   168 CRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAE 232

  Fly   335 ---------------------RRDNANEPVDFSRSEPGKQP 354
                                 ..::|:|..:.:.:.|..||
Zfish   233 LEAANLSHAAAQRIVRVPILYHENSASESTNTAGNVPVSQP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 32/55 (58%)
hmx3aNP_571709.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..172 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.