DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and dlx3

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001025566.1 Gene:dlx3 / 594954 XenbaseID:XB-GENE-5879293 Length:276 Species:Xenopus tropicalis


Alignment Length:249 Identity:73/249 - (29%)
Similarity:96/249 - (38%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFG 244
            |.|:..|..|.......|..:|.|...    .|.|.| |..| |||..:|....|:....   |.
 Frog    21 PVTKDSPTLPESTATDMGYYSGHLSGG----QHDFFQ-TQAY-SPSISSYGYHHPHHQYN---FN 76

  Fly   245 GAPFFGAPGCVPELALGLGMGVNALRHCRR---------------------------RKARTVFS 282
            |  ..|....:|:.....|.|..|..|.|.                           ||.||::|
 Frog    77 G--LVGNESFLPKDDYQYGGGYRAFGHYREPPVPETVSVKEEPETEVRMVNGKPKKIRKPRTIYS 139

  Fly   283 DPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSR 347
            ..||:.|::||:..:||:.|||.|||..|||::||||.||||||.|.||..:             
 Frog   140 SYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYK------------- 191

  Fly   348 SEPGKQPGEATSSSGDSKHGKLNPGSVG-GTPTQP---------TSEQQLQMCL 391
              .|:.||        .:|...|..|:. .:|:.|         |.:||.|..|
 Frog   192 --TGEGPG--------LEHSPNNSDSMACNSPSSPPVWDNSRSRTPQQQQQQSL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
dlx3NP_001025566.1 DLL_N 24..102 CDD:315147 22/88 (25%)
Abdominal-A 109..227 CDD:332641 42/140 (30%)
Homeobox 134..187 CDD:306543 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.