DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and hoxb6b

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:81 Identity:33/81 - (40%)
Similarity:47/81 - (58%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 RKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNA 339
            |:.|..::..|...|||.|...|||:...|:|::.||.|:|.|:|.||||||||.||:.:..::|
Zfish   148 RRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKAVNSA 212

  Fly   340 NEPVDFSRSEPGKQPG 355
            .    .|..|.|.:.|
Zfish   213 K----VSDEEDGGKAG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 26/55 (47%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134
Homeodomain 148..204 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.