DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and bsx

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:255 Identity:105/255 - (41%)
Similarity:121/255 - (47%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLS--PSSGTYK-SVDPYF- 236
            |.|.|..:..|.|         .||.:. ...|..::|:..|....|:  |....:| ...||| 
Zfish    28 HKPKPLREVFPSP---------FSNSIA-SRMPLLEYGYPLMPTPILAPHPHHPLHKPEHHPYFF 82

  Fly   237 ---LSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRY 298
               :...:||...|  ..||                :|||||||||||||.||||||||||.|||
Zfish    83 TSGMQMPALFQHHP--ELPG----------------KHCRRRKARTVFSDSQLSGLEKRFEIQRY 129

  Fly   299 LSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRR-RDNANEPVDFSRSEPGKQPGEATSSSG 362
            |||||||||||||.||||||||||||||||||||||: :|:...|.|..||.      |.||.| 
Zfish   130 LSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKTQDDQKTPNDVDRSL------ENTSES- 187

  Fly   363 DSKHGKLNPGSVGGTPTQPTSEQQLQMCLMQQGYSTDDYSDLEADSGDEDNSSDVDIVGD 422
             ..|.|...|..|.:|.:               |:.|            ||..||||..|
Zfish   188 -EMHEKNTDGKNGMSPDR---------------YTLD------------DNEDDVDIEDD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 48/51 (94%)
bsxNP_999892.1 Homeobox 109..161 CDD:278475 48/51 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6402
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006209
OrthoInspector 1 1.000 - - oto38758
orthoMCL 1 0.900 - - OOG6_109885
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3788
SonicParanoid 1 1.000 - - X4485
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.