DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Bsx

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001178924.1 Gene:Bsx / 500982 RGDID:1565120 Length:232 Species:Rattus norvegicus


Alignment Length:259 Identity:102/259 - (39%)
Similarity:120/259 - (46%) Gaps:79/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGF-LQMTLGYLSPSS------GTYKSVD 233
            |.|.|..:..|        ...||:  |....|..|:|: |..|...|:|.:      |.:.  .
  Rat    28 HKPKPLREVAP--------DHFASS--LASRVPLLDYGYPLMPTPTLLTPHTHHPLHKGEHH--H 80

  Fly   234 PYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNAL-----------RHCRRRKARTVFSDPQLS 287
            ||||:.:                      ||.|.||           :|||||||||||||.|||
  Rat    81 PYFLATS----------------------GMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLS 123

  Fly   288 GLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGK 352
            |||||||.||||||||||||||||.||||||||||||||||||||||:          |:.||..
  Rat   124 GLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRK----------SQDEPKA 178

  Fly   353 QPGEATSSSGDSKHGKLNPGSVGGTPTQPT-SEQQLQMCLMQQGYSTDDYSDLEADSGDEDNSS 415
            ..|               |.|..|:|..|. :....::.|....:...:..| |.|.|||...|
  Rat   179 ADG---------------PESPEGSPRAPEGAPADARLSLPAGAFVLTEPED-EVDIGDEGELS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 48/51 (94%)
BsxNP_001178924.1 Homeobox 114..166 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6326
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006209
OrthoInspector 1 1.000 - - oto97577
orthoMCL 1 0.900 - - OOG6_109885
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4485
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.